SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006436 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006436
Domain Number 1 Region: 61-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000775
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006436
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00366
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006436   Gene: ENSPANG00000006130   Transcript: ENSPANT00000011044
Sequence length 690
Comment pep:known_by_projection chromosome:PapAnu2.0:1:80963300:81077532:-1 gene:ENSPANG00000006130 transcript:ENSPANT00000011044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPLLVVFSTLLNCSYTQNCTKTPCLPNAKCEIRNGIEACYCNMGFSGNGVTICEDDN
ECGNLTQSCGENANCTNTEGSYYCMCVPGFRSSSNQDRFITNDGTICIENVNANCHLDNA
CIAANINKTLTKIRPIKEPVALLREVYRNSVTDLSPTDIITYIEILAESSSLLGYKNNTI
SVKDTLSNSTLTELVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVERATLRLSQSF
QKTTQFDTNSTDIALKVFFIDSSKMKHIHPHMNVDGDYINIFPKRKAAYNSNGNVAVAFL
YYKSIGPLLSSSDNFLLKPQNYDNSEEEERVISSVISVSMSSNPPMLYELEKITFTLSHR
KITDRYKSLCAFWNYSPDTMNGTWSSEGCELTYSNETHTSCRCNHMTHFAILMSSGPSIG
IKDYNILTRITQLGIIISLICLAICIFTFWFFSEIQSTRTTIHKNLCCSLFLAELVFLVG
INTNTNKLFCSIIAGLLHYFFLAAFAWMCIEGIHLYLIVVGVIYNKGFLHKNFYIFGYLS
PAVVVGFSAALGYRYYGTTKVCWLSTENNFIWSFIGPACLIILVNLLAFGVIIYKVFRHT
AGLKPEVSCFENIRSCARGALALLFLLGTTWIFGVLHVVHASVVTAYLFTVSNAFQGMFI
FLFLCVLSRKIQEEYYRLFKNVPCCFGCLR
Download sequence
Identical sequences A0A096N293
ENSPANP00000006436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]