SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006437 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006437
Domain Number 1 Region: 53-290,377-470
Classification Level Classification E-value
Superfamily TPR-like 2.97e-23
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006437   Gene: ENSPANG00000012072   Transcript: ENSPANT00000006707
Sequence length 864
Comment pep:known_by_projection chromosome:PapAnu2.0:17:19899979:19965119:1 gene:ENSPANG00000012072 transcript:ENSPANT00000006707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNVLLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLG
KKEEAYEFVRKGLRNDVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDL
SLLQIQMRDLEGYRETRYQLLQLRPTQRASWIGYAIAYHLLKDYDMALKLLEEFRQTQQV
PPNKIDYEYSELILYQNQVMREADLFQESLEHIETYEKQICDKLLVEEIKGEILLKLGRL
KEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPLTL
VPGERFRELMDKFLRVNFSKGCPPLFTTLKSLYYNTEKVSIIQELVTNYEASLKTCDFFS
PYEDGEKEPPTTLLWVQYFLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIYKH
IGNLREAAKWMDEAQSLDTADRFINSKCAKYMLRANMIKEAEEMCSKFTREGTSAMENLN
EMQCMWFQTECISAYQRLGRYGDALKKCHEVERHFFEITDDQFDFHTYCMRKMTLRAYVD
LLRLEDILRRHAFYFKAARSAIEIYLKLYDNPLTNESKQQEINSENLSAKELKKMLSKQR
RAQKKAKLEEERKHAERERQQKNQKKKRDEEEEEASGLKEELIPEKLERVENPLEEAVKF
LIPLKNLVADNIDTHLLAFEIYFRKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVS
NHSNLPDIVSQVLSQEMQKIFVNKDLESFNEDFLKHNATSLQHLLSGAKMMYFLDKSRQE
KAITIATRLDETIKDKNVKTLIKVSEALLDGSFGNCSSQYEEYRMACHNLLPFTSAFLPA
VNEVDNPNVALNHTANYDVLANEI
Download sequence
Identical sequences A0A096N294
ENSPANP00000006437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]