SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006445 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006445
Domain Number 1 Region: 213-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000112
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 271-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000285
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006445
Domain Number - Region: 182-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00102
Family LIM domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006445   Gene: ENSPANG00000019414   Transcript: ENSPANT00000011130
Sequence length 375
Comment pep:known_by_projection chromosome:PapAnu2.0:1:18223869:18246084:1 gene:ENSPANG00000019414 transcript:ENSPANT00000011130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWVAPAPVKTPEAGLARRP
SPWTPPGKAATTVPAAPLQLSNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEE
APAPMGTSLIADLQQLHLSPYRKPASPQAPVEGPSVQPGPLRPMEEELPPPPAEPVEKEA
STDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQD
TLEKCGKCGEVVQDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRK
FAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNRL
FCKPCHVKRSAAGCC
Download sequence
Identical sequences ENSPANP00000006445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]