SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006467 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006467
Domain Number 1 Region: 91-188
Classification Level Classification E-value
Superfamily SH2 domain 1.1e-22
Family SH2 domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006467   Gene: ENSPANG00000008351   Transcript: ENSPANT00000000320
Sequence length 371
Comment pep:known_by_projection chromosome:PapAnu2.0:1:130699682:130709366:-1 gene:ENSPANG00000008351 transcript:ENSPANT00000000320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPLAQICPQGSHEAPIPTFSTFQITDMTHRSCRNLGYTAASPQALEAASIPGNAERAE
EVPGEGSLSLQAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLELKPQGCYLVR
FSESAVFVLTYRSRTCCRHFLLAQLGDGRHVVLGEDSAHERLQDLLRHYTAHPLSPYGET
LTEPLARQQTPEPAGLPLRTEESNSGSKSQDPNPEYSPIIKQGQATVPMQKEAAGEKEPS
QPLRPKPPIPAKPQLPPEVYTSPVSRRLPAPPPKPSNPIYNEPDEPIAFYAMGRGSPGEA
PSNIYVEVEDEGPPATLGHPVLRKSRSRPVPGGQNTGGSQLHSENSVIGQDLSRQVLQDR
GQAWLPLGPPQ
Download sequence
Identical sequences ENSPANP00000006467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]