SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006544 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006544
Domain Number 1 Region: 30-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000146
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000262
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006544
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006544   Gene: ENSPANG00000015539   Transcript: ENSPANT00000008370
Sequence length 444
Comment pep:known_by_projection chromosome:PapAnu2.0:14:43876363:44232849:-1 gene:ENSPANG00000015539 transcript:ENSPANT00000008370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDVILVVWFCVCTARTVVGFGMDPDLQMDIITELDLVNTTLGVAQVTGMHNASKAFLF
QDMEREIHAAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHSGKPRTEALPYRMADGRWHKIALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEGNFIMALFMTW
Download sequence
Identical sequences ENSPANP00000006544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]