SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006549 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006549
Domain Number 1 Region: 50-352
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000286
Further Details:      
 
Domain Number 2 Region: 4-56
Classification Level Classification E-value
Superfamily SH2 domain 0.000000457
Family SH2 domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006549   Gene: ENSPANG00000017824   Transcript: ENSPANT00000005587
Sequence length 366
Comment pep:known_by_projection chromosome:PapAnu2.0:11:111648513:111692794:1 gene:ENSPANG00000017824 transcript:ENSPANT00000005587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRV
RELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRV
VLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENS
RVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQGN
TERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFI
VIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIE
EEQVPA
Download sequence
Identical sequences ENSPANP00000006549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]