SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006588 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006588
Domain Number 1 Region: 46-207
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000317
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 154-252,285-344
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000172
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 3 Region: 363-494
Classification Level Classification E-value
Superfamily TPR-like 0.000000171
Family CT2138-like 0.081
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006588
Domain Number - Region: 472-549
Classification Level Classification E-value
Superfamily AF0941-like 0.0719
Family AF0941-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006588   Gene: ENSPANG00000007701   Transcript: ENSPANT00000018713
Sequence length 554
Comment pep:known_by_projection chromosome:PapAnu2.0:3:160917711:160986168:1 gene:ENSPANG00000007701 transcript:ENSPANT00000018713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRAKPAVGRGVQPTDKKKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNL
WIGYCAFHLGDYKRALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKAASKS
RLQNRLLFHLAHKFNDEKKLMSFHQNLQDVTEDQLSLASIHYMRSHYQEAIDIYKRILLD
NREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLKACNHFRLYNGRAAEA
ELKSLMDNASSSFEFAKELIRHNLLFFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDD
VQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIP
GRQCMASCFFLLKQFDDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQ
SEKMKNDYIYLSWLARCYIMNKKPRLAWELYLKMETSGESFSLLQLIANDCYKMGQFYYS
AKAFDVLERLDPNPEYWEGKRGACVGIFQMIVAGREPKETLREVLHLLRSTGNTQVEYMI
RIMKKWAKENRVPI
Download sequence
Identical sequences ENSPANP00000006588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]