SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006590 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006590
Domain Number 1 Region: 47-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.95e-121
Family Bee venom hyaluronidase 0.0000177
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006590
Domain Number - Region: 429-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0139
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006590   Gene: ENSPANG00000012990   Transcript: ENSPANT00000029286
Sequence length 481
Comment pep:known_by_projection chromosome:PapAnu2.0:3:146019609:146034751:1 gene:ENSPANG00000012990 transcript:ENSPANT00000029286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLSEGQLRLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLKV
HLEKADQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNAKDVYRKKSRKLIADMGKNVSA
MDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYTGSCPEE
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSQFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTSSKANCTKVKQFVSS
DLGSYIANVTRAAEVCSFHLCRNNGRCIRKMWNSPTYLHLNPASYHIEASEDGEFTVKGR
ASDADLAVMADTFSCHCYRGYEGADCREVKTADGCSGVSPSPGSLMTLCLLLLASYRSIH
L
Download sequence
Identical sequences A0A096N2P6
ENSPANP00000006590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]