SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006605 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006605
Domain Number 1 Region: 521-729
Classification Level Classification E-value
Superfamily RNI-like 4.32e-17
Family 28-residue LRR 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006605
Domain Number - Region: 85-128
Classification Level Classification E-value
Superfamily PH domain-like 0.000695
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006605   Gene: ENSPANG00000000893   Transcript: ENSPANT00000014349
Sequence length 733
Comment pep:known_by_projection chromosome:PapAnu2.0:20:63352447:63450984:1 gene:ENSPANG00000000893 transcript:ENSPANT00000014349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRDREASFGRQRCRAPAPAPFACRYRGNVSRNHPRCGRHAYSCNQCMSLLFLFFFLLQ
PTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKK
KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQ
EHENIIVAIAPLLENNHPPPDLCEFFCKHCRERPRSMVVIEVFTPVVQRILKHNMDFGKC
PRLRLFTQEYILALNELNAGMEVVKKFIQSMHGPTGHCPHPRVLPNLVAVCLAAIYSCYE
EFINSRDNSPSLKEIRNGCQQPCDRKPTLPLRLLHPSPDLVSQEATLSEARLKSVVVASS
EIHVEVERTSTAKPALTASAGNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEIL
KLLSDYDDWRPSLASLLQPIPFPKEALAHEKFTKELKYVIQRFAEDPRQEVHSCLLSVRA
GKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRGN
QTMVEILCLMLEYNIIDNNDTQLQIISTLESTDVGKRMYEQLCDRQRELKELQRKGGPTR
LTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLP
NLKEVDVRYTEAW
Download sequence
Identical sequences ENSPANP00000006605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]