SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006621 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006621
Domain Number 1 Region: 353-487
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.84e-41
Family Synaptotagmin-like (S variant) 0.00000582
Further Details:      
 
Domain Number 2 Region: 214-327
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-38
Family Synaptotagmin-like (S variant) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006621   Gene: ENSPANG00000017377   Transcript: ENSPANT00000023485
Sequence length 491
Comment pep:known_by_projection chromosome:PapAnu2.0:14:57272426:57499190:-1 gene:ENSPANG00000017377 transcript:ENSPANT00000023485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVT
ACGLALFGVSLFVSWKLCWVPWRERGLPSGSKDNNQEPLNYTDTETNEQENSEDFLDPPT
PCPDSSMKISHTSPDIPLSAQTGVQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPD
FNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRQSNSKACGKLNFILKYDCDLEQLVVK
IHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEA
RKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSL
CYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKP
IAHWHSLVEKR
Download sequence
Identical sequences A0A096N2S7 A0A2K5KW82 A0A2K5Y4C6
XP_011827054.1.47321 XP_011919070.1.92194 ENSPANP00000006621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]