SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006679 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006679
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-30
Family Spermadhesin, CUB domain 0.000000448
Further Details:      
 
Domain Number 2 Region: 174-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-24
Family Spermadhesin, CUB domain 0.0000664
Further Details:      
 
Domain Number 3 Region: 359-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000416
Family Complement control module/SCR domain 0.0000164
Further Details:      
 
Domain Number 4 Region: 305-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000297
Family EGF-type module 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006679
Domain Number - Region: 418-455
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000481
Family Eukaryotic proteases 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006679   Gene: ENSPANG00000012264   Transcript: ENSPANT00000008238
Sequence length 470
Comment pep:novel chromosome:PapAnu2.0:11:7198301:7209802:1 gene:ENSPANG00000012264 transcript:ENSPANT00000008238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIILFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIMSGDIEEGRLCGQRTSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDAPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEEGFQVVVTVRREDFDVEPADSKGNCLDSLVF
VAGDQQFGPYCGHGFPGPLNIETKSNVLDIIFQTDLTGQNKGWKLRYHGDPIPCPKEETP
TSVWEPAKAKYVFRDVVRITCLDGFEVVEGRVGATSFHSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVTRYTCEEPYYYMENGGNGQYHCASNGSWVNEALSPELPK
CVPVCGVPREPFEGKQRIIGGSDADIKNFPWQVFFDNPGLVERSLMSTGC
Download sequence
Identical sequences ENSPANP00000006679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]