SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006748 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006748
Domain Number 1 Region: 5-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.09e-119
Family Calpain large subunit, catalytic domain (domain II) 0.000000113
Further Details:      
 
Domain Number 2 Region: 354-498
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.27e-39
Family Calpain large subunit, middle domain (domain III) 0.00015
Further Details:      
 
Domain Number 3 Region: 520-616
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-16
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006748   Gene: ENSPANG00000010115   Transcript: ENSPANT00000010581
Sequence length 640
Comment pep:known_by_projection chromosome:PapAnu2.0:14:66914437:66972286:1 gene:ENSPANG00000010115 transcript:ENSPANT00000010581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCVKPYEDQNYSALRRDCLRRKVLFEDPLFPATDDSLYYKGTPGPTVRWKRPKDICED
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGI
FHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGG
NTADALVDFTGGVSEPIDLTEGDFASDETKRNQLFERMLKVHSRGGLISASIKAVTAADM
EARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
EWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRLINTSYLSIHKTWEEARLH
GAWTLHEDPRQNRSGGCINHKDTFFQNPQYIFDVKKPEDEVLICIQQRPKRSTRREGKGE
NLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGYT
GEFLLRVFTDVPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYV
IIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLTAD
PDDLQALHTLHLRDRNSRQPSDLPGTVAVHILSSTSLMAV
Download sequence
Identical sequences A0A096N342
ENSPANP00000006748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]