SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006763 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006763
Domain Number 1 Region: 136-516
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 493-618
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.67e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000242
Further Details:      
 
Domain Number 3 Region: 34-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000134
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006763   Gene: ENSPANG00000012060   Transcript: ENSPANT00000019486
Sequence length 623
Comment pep:known_by_projection chromosome:PapAnu2.0:11:103403736:103577921:1 gene:ENSPANG00000012060 transcript:ENSPANT00000019486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSAAKDHHPGKTLPENPAGFTSTATADLRALLQAYIDGHSVVIFSRSTCTRCAEVKK
LFKSLCVPYFVLELDQTEYGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGR
LQKLLKMNGPEDLPESYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWG
LGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNW
GYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDK
EYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMAN
KIGEHMEEHGIKFIRQFVPIKIEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVLLAIGRD
ACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLA
QRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIP
SRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPV
CAEVFTTLSVTKRSGASILQAGC
Download sequence
Identical sequences ENSPANP00000006763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]