SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006795 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006795
Domain Number 1 Region: 310-435
Classification Level Classification E-value
Superfamily TPR-like 4.96e-19
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 2 Region: 122-225
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000081
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006795   Gene: ENSPANG00000011012   Transcript: ENSPANT00000012644
Sequence length 778
Comment pep:known_by_projection chromosome:PapAnu2.0:2:104990638:104999728:-1 gene:ENSPANG00000011012 transcript:ENSPANT00000012644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRDLLRQSLNCHGSSLLSLLRSEQQDNPHFRSLLGSAAEPTRGPPPQQPLQGRRKEKRV
DNIEIQKFISKKADLLFALSWKSDAPATSEINEDSEEDHYAVMPPLEQFMEIPSMDRREL
FFRDIERGDIVIGRISSIREFGFFMVLICLGSGIMRDIAHLEITALCPLRDVPSHSNHGD
PLSYYQTGDIIREAGIKDIDRYHEKLAVSLYSSSLPPHLSGIKLGVISSEELPLYYRRRS
VELNSNSLESYENIMQSSLGFVNPGVVEFLLEKLGIDESNPPSLMRGLQSKNFSEDDFAS
ALRKKQSASWALKCVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEALVARGALYATKGS
LNKAIEDFELALENCPTHRNARKYLCQTLVERGGQLEEEEKFLNAESYYKKALALDETFK
DAEDALQKLHKYMQKSLELREKQALKRREEETNRAHIFMNNLETFLYIYDRRLKKKRRKS
TSSSSSVSSADESVSSSSSSSSSGHKRHKKHKRNRSESSRSSRRHSSRASSSQIDQNRKD
ECYPVPANTSASFLNHKQEVEKLLGKQDRLQYEKTQIKEKDRCPLSSSSLEIPDDFGGRS
EDPRDFCNSYRTQAGSSKTEKPYKSERHFSSRRNSSDSFCRNSEDKIYGYRRFEKDIEGR
KEHYRRWEPGSVRHSTSPASSDYSWKSVEKYKKYTHSGSRDFSRHEQRYRLNTNQGEYER
EDNYGEDVKTEVPEEDALSSKEHSESSVKKNLPQNLLNIFNQIAEFFLCKGKSEKKKN
Download sequence
Identical sequences ENSPANP00000006795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]