SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006801 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006801
Domain Number 1 Region: 140-329
Classification Level Classification E-value
Superfamily TPR-like 2.31e-23
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 2 Region: 21-54,83-178
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000114
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 
Domain Number 3 Region: 365-423
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000132
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006801   Gene: ENSPANG00000004124   Transcript: ENSPANT00000010354
Sequence length 428
Comment pep:known_by_projection chromosome:PapAnu2.0:14:17729232:17740626:1 gene:ENSPANG00000004124 transcript:ENSPANT00000010354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTPRGAQGLGSMGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKSSDLMGRFRVLGCL
VTAHSEMGRYKEMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTC
LGLPGTRAGAQLGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSL
GSFYAQVKDYEKALFFPCKAAELVNDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECC
EESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQAL
LGVAKCWVARKALDKALDVIERAQDLAEEVGNKSRGPQLSQLKLHCLSESIYRSKGLQRE
LRAHVVRFHECVEETELYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRR
SSMKPGFV
Download sequence
Identical sequences ENSPANP00000006801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]