SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006817 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006817
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.002
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000002
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006817   Gene: ENSPANG00000017058   Transcript: ENSPANT00000010403
Sequence length 346
Comment pep:known_by_projection chromosome:PapAnu2.0:8:46404184:46660209:1 gene:ENSPANG00000017058 transcript:ENSPANT00000010403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
SGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILK
Download sequence
Identical sequences ENSPANP00000006817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]