SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006827 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006827
Domain Number 1 Region: 524-714
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-66
Family Sec7 domain 0.00000475
Further Details:      
 
Domain Number 2 Region: 746-870
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000205
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006827   Gene: ENSPANG00000006877   Transcript: ENSPANT00000010557
Sequence length 1130
Comment pep:known_by_projection chromosome:PapAnu2.0:2:47221072:47393899:1 gene:ENSPANG00000006877 transcript:ENSPANT00000010557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACRRRYLSSLDTGSSLSTDRYSVEGEAPSSETGTSLDSPSAYPQGPLVPGSSLSPDHYE
HTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDK
QVEMLERKYGGRLVTRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQF
SFEGPEKVHSSYFEGKQVSVTNDGSQLGALVPPECGDLSEPTTLKSPAPSSDFADAITEL
EDAFSRQVKSLAESIDDALNCRSLHTEEAPALDAARARDTEPQTALHSMDHRKLDEMTAS
YSDVTLYIDEEELSPPLPLSQAGDRPSSTESDLRLRAGGAAPDYWALAHKEDKADTDTSC
RSTPSLERQEQRLRVEHLPLLTIEPPSDSSVDLSDRSERGSLKRQSAYERSLGGQQGSPK
HGPHSGPPKSLPREEPELRPRPPRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNS
NDTINCSSESSSRDSLREQTLSKQTYHKEARNSWDSPAFSNDVIRKRHYRIGLNLFNKKP
EKGVQYLIERGFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDF
STMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAI
ILLNTDMYSPNVKPERKMKLEDFIKNLRGVDDGEDIPRDMLIGIYERIRKRELKTNEDHV
SQVQKVEKLIVGKKPIGSLHPGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIF
LFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSSVPGADIKVL
INFNAPNPQDRKKFTDDLRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGN
GTLSRACLDDSYASGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEGSIISSPHMR
RRATSTRECPSRPHQTMPNSSSLLGSLFGSKRGKPPPQAHLPSAPAPPPPHPPVVLPHLQ
HSVAGHHLGPPEGLPQAPVHGHHTQYCHMQQNPPPYHHHHHHHPPQHIQHAHQYHHGPHG
GHPAYGAHAHGHPPLSAAHMGHTAHHHGQPPAPPPPTSSKAKPSGISTIV
Download sequence
Identical sequences A0A096N3B7
ENSPANP00000006827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]