SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006836 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006836
Domain Number 1 Region: 216-335
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-28
Family SH2 domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006836   Gene: ENSPANG00000011888   Transcript: ENSPANT00000008000
Sequence length 340
Comment pep:known_by_projection chromosome:PapAnu2.0:19:4094796:4106576:1 gene:ENSPANG00000011888 transcript:ENSPANT00000008000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGP
GDSKNPGDAKYGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYSDPFDAQPHPAPPD
DGYMEPYDAQRVMSELPGRGVQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADE
YDQPWEWKKDHISRAFAVQFDSPEWERTPGSAKELRRPPPRSPQPAERVDPALPLEKQPW
FHGPLNRADAESLLSLCKEGSYLVRLSETSPQDCSLSLRSSQGFLHLKFARTRENQVVLG
QHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP
Download sequence
Identical sequences A0A0A0MVI4 A0A0D9RE21 A0A2K6C207 G7NLW6
ENSPANP00000006836 XP_007993036.1.81039 XP_011745899.1.29376 XP_014977998.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]