SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006857 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006857
Domain Number 1 Region: 48-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-64
Family NQO2-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006857   Gene: ENSPANG00000008383   Transcript: ENSPANT00000008551
Sequence length 242
Comment pep:novel chromosome:PapAnu2.0:18:4363936:4381451:-1 gene:ENSPANG00000008383 transcript:ENSPANT00000008551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFYSWSFRTNLGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIV
KNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPV
GKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQ
INDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQA
GL
Download sequence
Identical sequences ENSPANP00000006857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]