SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006868 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006868
Domain Number 1 Region: 567-764
Classification Level Classification E-value
Superfamily PUA domain-like 3.48e-39
Family LON domain-like 0.0075
Further Details:      
 
Domain Number 2 Region: 221-324
Classification Level Classification E-value
Superfamily TPR-like 2.08e-17
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 475-537
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-16
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 4 Region: 119-164
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000119
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006868
Domain Number - Region: 38-94
Classification Level Classification E-value
Superfamily TPR-like 0.0603
Family Tetratricopeptide repeat (TPR) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006868   Gene: ENSPANG00000002438   Transcript: ENSPANT00000009355
Sequence length 773
Comment pep:known_by_projection chromosome:PapAnu2.0:8:10544478:10576983:-1 gene:ENSPANG00000002438 transcript:ENSPANT00000009355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPAVARSSPGGSREMAPAPQGRGRFWEVGGGSGLRLERAAAESERWELLLRRGELLAL
GGHLKGALEAFAAALRRGAPARPECLGALVDCLVFNYRLRHGLSWSAAPAAGADGGACGL
LRCLGCRGFLSEPVTVPCGHSYCRRCLRRELRARCRLCRDRLPPATASATDAEGTAPRPP
PLAAAIAASDFRTSVVLNHLAEKWFPGQRERARAAGRLGELLHQGRYREALAAACEALRA
EPSDLIVKIYRAESYAGLQEFKAAIEDLNAVLFQLPDWPEVYFRKGKVLYDAGFLGDALQ
LFLQCLALDEDFAPAKLQVQKILCDLLLPENLKEGLRGSSWSSLPCTKNRPFDFPSVMEE
SQSASEPSPKQSEEIPEVTSEPVKGSLNRAQSAQSINSTETPAREDCLKRVSSEPVLSVQ
EKGVLLKRKLSLLEQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECS
LCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVTQLLEELIV
KYLPDELSERKKIYDEETAELSHLTKNVPIFVCTMAYPTVPCPLHVFEPRYRLMIRRSIQ
TGTKQFGMCVSDTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGKRFRVLKRGMKDGYCT
ADIEYLEDVKVEDEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQHFGSMPEREENL
QATPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLKERLTKIQHILTYFSRDQSK
Download sequence
Identical sequences A0A096N3F6
ENSPANP00000006868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]