SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006876 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006876
Domain Number 1 Region: 300-414
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 144-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-33
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 3 Region: 464-576
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.4e-28
Family Frizzled cysteine-rich domain 0.0003
Further Details:      
 
Domain Number 4 Region: 258-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 419-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006876   Gene: ENSPANG00000022408   Transcript: ENSPANT00000002427
Sequence length 579
Comment pep:novel chromosome:PapAnu2.0:14:108690774:108695734:-1 gene:ENSPANG00000022408 transcript:ENSPANT00000002427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDVILCVEATESSKTEFCNPAFEPESGPSCPPPAFPEDASYSVPAPWHGRRPRGLR
PDCRFSWLCVLLLASLLLLLLGLLVAIILAQLQAAPLPGASHSPLPARGLTTTTTTPTIT
TSQAAGTPKGQQESGVSPSPQATCGGLLSGPRGFFSSPNYPDPYPPNTHCMWRIQVATDH
AIQLKIEALSIESVASCLFDRLEISPEPEGSLLRICGRVPPPTLNTNASHLLVAFVSDSS
VEGFGFHAWYQAVAPGHGSCAHDEFRCDQLICLLPDSVCDGFANCADSSDETNCSAKFSG
CGGNLTGLQGTFSTPNYLQQYPHQQLCTWHISVPAGHSIELQFHNFSLEAQDECKFDYVE
VYETSSSGAFSLLGRFCGAEPPPHLVSSHHELAVLFRTDHGISSGGFSATYLAFNATENP
CGPSELSCQAGGCKGVQWMCDMWRDCTDGSDDNCSRPLFPPPELACEPVQVEMCLGLSYN
TTAFPNIWVGMATQEEVVEVLSGYKSLTSLPCYQNFRRLLCGLLVPRCTPLGSVLPPCRS
VCQEAEHQCQSGLALLGTPWPFNCNRLPEAAGLEACSQP
Download sequence
Identical sequences A0A096N3G3
ENSPANP00000006876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]