SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006880 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006880
Domain Number 1 Region: 376-614,647-714
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.98e-53
Family Diacylglycerol kinase-like 0.024
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily EF-hand 2.67e-48
Family EF-hand modules in multidomain proteins 0.00000255
Further Details:      
 
Domain Number 3 Region: 186-252
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 4 Region: 99-183
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000581
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 5 Region: 256-324
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000882
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006880   Gene: ENSPANG00000019457   Transcript: ENSPANT00000019897
Sequence length 735
Comment pep:known_by_projection chromosome:PapAnu2.0:11:51501972:51528601:1 gene:ENSPANG00000019457 transcript:ENSPANT00000019897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLRIY
LEVDNVPRHLSLALFQSFKTDHCLNEANVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDGRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLETSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRKPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
Download sequence
Identical sequences A0A096N3G6
ENSPANP00000006880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]