SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Papio anubis 76 > ENSPANP00000006883

Domain assignment for ENSPANP00000006883 from Papio anubis 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSPANP00000006883
Domain Number 1 Region: 561-633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-19
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 169-237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.0000188
Further Details:      
 
Domain Number 3 Region: 108-180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-17
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 4 Region: 622-690
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-16
Family Complement control module/SCR domain 0.0000731
Further Details:      
 
Domain Number 5 Region: 953-1018
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000162
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 755-817
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000283
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 7 Region: 302-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000364
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 8 Region: 877-946
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 9 Region: 424-493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 10 Region: 244-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000723
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 695-758
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1009-1071
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000391
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 13 Region: 367-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 821-888
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 47-112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000378
Family Complement control module/SCR domain 0.0003
Further Details:      
 
Domain Number 16 Region: 501-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000836
Family Complement control module/SCR domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006883   Gene: ENSPANG00000009661   Transcript: ENSPANT00000006568
Sequence length 1165
Comment pep:novel chromosome:PapAnu2.0:1:156320499:156440698:-1 gene:ENSPANG00000009661 transcript:ENSPANT00000006568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGLGRMGASSPRSPEPVGPLAPRLLFCCGGSLLAVVVLLALPVAWGQCNAPEQLPFARPT
ELIDEPEFSIGTHLKYECRPGYYGRPFSIICLKNSVWTSAKDKCIRKSCRNPRDPVNGMV
HVIKDIQFGSQINYSCTEGHRLIGSSSATCIISGNTVIWDNETPICEKISCGLPPTIDNG
DFFSANKEYFHYGSVVTYHCNLGSGGRKLFELVGEPSIYCTSNEDQVGIWSGPAPQCIIP
NKCTPPNVENGILVSVNRSLFSLNEVVEFRCQPGFVMKGPRRVQCQALNKWEPELPSCSR
VCQPPPEILHGEHTPSHQDKFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAV
KSCDDFLGQLHHGRVLVPFNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPV
CEHIFCPNPPAILNGRHTGALLGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDLQ
GNGVWSSPAPRCELSVRAGHCKTPEQFPFASPTIPINDFEFPVGTSLNYECHPGYFGRMF
SISCLENLVWSSVEDNCRRKSCGTPPEPFNGMVHINTDTQFGSTVNYSCNEGFRLIGSPS
TTCLVSGNNVTWDKEAPICEIISCKPPPTISNGDFYSNNRTSFHSGTVVTYQCHTGPDGE
QLFELVGERSIYCTSKDDQVGAWSSPPPRCISTNKCTAPEVKNGIRVPGNRSFFSLNEIV
RFRCQPGFVMVGSHTVQCQTNNRWGPKLPHCSRVCQPPPEILHGEHTPSHQDKFSPGQEV
FYSCEPGYDLRGAASLHCTPQGDWSPEAPICTVKSCDEFLGQLPHGRVLFPLNLQLGAKV
SFVCDEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPLGDIPY
GEEISYTCDPHPDRGMTFDLIGESTIRCTSDLQGNGVWSSPAPRCELSVPAACPHPPKIQ
NGHYIGGHVSLYLPGMTISYICDPGYLLVGKGIIFCTDQGIWSQLDHYCKEVNCSFPQFM
NGISKELEMKKVYHYGDYVTLECEDGYALEGSPWSQCQADDRWDPPLAICTSRARDALIV
GTLSGMIFVILFIIFLSWIILKYRKGNNAHEKPKEVPIHIHSPGGSSVHPQTLQTNEENS
XXXXXXXXXXXXXXXXXXHIAEDLG
Download sequence
Identical sequences ENSPANP00000006883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.