SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006896 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006896
Domain Number 1 Region: 37-76
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000301
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006896   Gene: ENSPANG00000015348   Transcript: ENSPANT00000025237
Sequence length 92
Comment pep:known_by_projection chromosome:PapAnu2.0:1:125528571:125536841:1 gene:ENSPANG00000015348 transcript:ENSPANT00000025237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLPSLLRRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKR
PDNILEFAADYFTDPRLPSKIHMQLIKDKKVA
Download sequence
Identical sequences A0A096N3I2
ENSPANP00000006896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]