SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006936 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006936
Domain Number 1 Region: 789-916
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-29
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 2 Region: 386-510
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.02e-28
Family PLC-like (P variant) 0.013
Further Details:      
 
Domain Number 3 Region: 541-675
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-21
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006936   Gene: ENSPANG00000008927   Transcript: ENSPANT00000016723
Sequence length 925
Comment pep:known_by_projection chromosome:PapAnu2.0:3:179809363:179906282:-1 gene:ENSPANG00000008927 transcript:ENSPANT00000016723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRAAALSSPRHPGCAQRPRTPTPAISSQGRSVFGFDDGNFPRLEERSHAPGSRLAARRCA
RTARGLRGHRRRGAGAGLSRPGSARAPSPPRPGGQRGRAAPENPGGVLSLELPGLLAQLA
RSFALLLPVYALGYLGLSFSWVLLALALLAWCRRSRGLKALRLCRALALLEDEERAVRLG
VRACDLPAWWVHFPDTERAEWLNKTVKHMWPFICQFIEKLFRETIEPAVRGANTHLSTFS
FTKVDMGQQPLRINGVKVYTENVDKRQIILDLQISFVGNCEIDLEIKRYFCRAGVKSIQI
HGTMRVILEPLIGDMPLVGALSIFFLRKPLLEINWTGLTNLLDIPGLNGLSDTIISDMIS
NYLVLPNRITVPLVSEVQIAQLRFPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYG
IIRVGNQIFQSKVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDL
IEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNASNLDKVLTDIRADKDQANDGLSSA
LLILYLDSARNLPSGKKISSNPNPVVQMSVGHTAQESKIRYKTNEPVWEENFTFFIHNPK
RQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTLNQRFQLSNSGPNSTIKMKIALWVLH
LEKRERPPNHQHSAQVKRPSVSKEGRKTSVKSHMSGSPGPGGSNTAPSTPVMGGSDKPGV
EEKAQPPEAGPQGLHDLGRSSSSLLASPGHISAKEPTPSIASDISLPIATQELRQRLRQL
ENGTTLGQSPLGQIQLTIRHSSQRNKLIVVVHACRNLIAFSEDGSDPYVRMYLLPDKRRS
GRRKTHVSKKTLNPVFDQSFDFSVSLPEVQRRTLDVAVKNSGGFLSKDKGLLGKVLVALA
SEELAKGWTQWYDLTEDGTRPQVMT
Download sequence
Identical sequences ENSPANP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]