SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006978 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006978
Domain Number 1 Region: 1537-1601
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.29e-19
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 2 Region: 144-217
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000113
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1108-1171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000723
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 4 Region: 1294-1357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000229
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 5 Region: 867-927
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0000245
Further Details:      
 
Domain Number 6 Region: 1479-1539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000113
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 7 Region: 627-684
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000183
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 1041-1103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000021
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 9 Region: 85-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 10 Region: 924-985
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000367
Family Complement control module/SCR domain 0.0000371
Further Details:      
 
Domain Number 11 Region: 689-744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000378
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 12 Region: 982-1044
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000786
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 809-864
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000498
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 14 Region: 508-572
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000131
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 15 Region: 262-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000328
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 16 Region: 393-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000537
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 17 Region: 561-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000708
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 18 Region: 209-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000128
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 19 Region: 1417-1473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000183
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 20 Region: 455-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000315
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 21 Region: 1230-1288
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000668
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 22 Region: 26-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000183
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006978
Domain Number - Region: 1167-1227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000354
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number - Region: 1352-1412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000367
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number - Region: 324-384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00148
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Domain Number - Region: 751-803
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00297
Family Complement control module/SCR domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006978   Gene: ENSPANG00000012544   Transcript: ENSPANT00000025768
Sequence length 1602
Comment pep:novel chromosome:PapAnu2.0:1:167086700:167336358:-1 gene:ENSPANG00000012544 transcript:ENSPANT00000025768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLAKIICLMLWAICVAEDCKELPPRKNTEILTGSWPDHTYPEGTEAIYKCRPGYRSLG
NIVMVCRKGEWVALNPLKKCQKRPCGHPGDTPFGYFSLIGGNVFEYGVKAVYTCNEGYQL
LGEINYRECDTDGWTNDIPICEVVKCLPVKPPENGKIISGAMEPDREYYFGQVVRFACNS
GYKIEGDNEMHCSEDGVWSKEKPKCVEISCKSPDVIHGSPISQKIIYKENERFQYKCNMG
YEYSERGDSVCTESGWHPLPSCEEKTCNVPHIPNGVYSPLRIKHRTGDEIRYQCINGFYP
ATRGNTAKCTSSGWIPAPRCALRPCDYPDIKHGGLYYDSMRRPYFPVPVGKYFSYYCDEL
FETPSGSYWDYIHCTQDGWSPAVPCLRKCYFHYLANGYNENNGRKFVQGNTVEVACHPGY
SLPKEQTTVTCTENGWSPTPKCIRVKTCSKSSIDIKNGFISESQYTYALNKQAKYQCKLG
YITADGETSGSITCRKNGWSAQPTCIKSCDMPVFKNARAKNNITWFKLNDTLDYECHDGY
ESNTGSTTSSIVCGDNGWSDLPVCYERECELPKIDVHLVPDPKKDQYKVGEVLKFSCKLG
FTRVGPNSVQCYHFGLSPDIPTCKEQVRSCGPPPELLNGNVKEKTKEEYRHSEVVEYYCN
PRFLLKGPNKIQCVDGAWTALPVCIEEESTCGDIPELEHGYSELSSPPYYYGDSVEFNCS
ESFTMIGHRSITCIHGVWTQLPQCVATDQLKKCKSPNSIVIVENLTSKKEFDHNSTMRYR
CKGKGERLHAVCINGRWDPEVTCSMAQIQLCPPPPQIPNSRNMTTTLNYQDGEKVSLLCQ
ENYLIKEGEEITCQDGRWQSIPHCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYT
CEYGFWLSEENEITCYMGKWSSPPQCEGLPCKSPPEISHGVVAHTSDSYQYGEEVTYKCS
EGFGIDGPPIAKCLGEKWSRPPSCIKTDCLSLPSFENAKPMGEKKDSYKSGEQVTYTCAT
NYKMDGPSTVTCINSRWTGRPTCRDTSCVDPPTVKNAHLVSRQMSQYASGERVRYECRSP
YEMFGDEEVMCVNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSLYAPDSSVEYKCQK
LYQLEGNKRITCRNGQWSDPPKCLLRPCHFPDIKHGSLYYESMRRPYFPVPVGKYFSYYC
DESFETPSGSYWDYIHCTQDGWSPAVPCLRKCYFPYLENGYNENNGRKFVQGNSIEVACH
PGYGLRNEQTAVNCTENGWSPTPRCIHVNSTRKCGPPPPIDNGDTTSFPLSLYAPDSSVE
YQCQNLYQLEGNKRVTCRNGQWSEPPKCLLRPCHFPDIKHGSLYYESMRRPYFPVPVGKY
FSYYCDESFETPSGSYWDYIHCTQDGWSPAVPCLRKCYFPYLENGHNENNGRKFVQGNFI
EVACHPGYGLPKEQTTVTCTENGWSPTPRCIHVNSTRKCGPPPPIDNGDTTSFPLSLYAP
DSSVEYQCQNLYQLEGNKRVTCRNGQWSEPPKCLHACVIAPEIMEKYNITFKWAAKQKLY
SRTGEPVEFVCRSGYHLSPNSHALRTTCQDGKLEYPTCVKRY
Download sequence
Identical sequences ENSPANP00000006978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]