SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007008 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007008
Domain Number 1 Region: 184-652
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.1e-59
Family Hermes transposase-like 0.00064
Further Details:      
 
Domain Number 2 Region: 23-80
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000115
Family BED zinc finger 0.0000611
Further Details:      
 
Domain Number 3 Region: 120-178
Classification Level Classification E-value
Superfamily Hermes dimerisation domain 0.0000000732
Family Hermes dimerisation domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007008   Gene: ENSPANG00000011132   Transcript: ENSPANT00000004230
Sequence length 694
Comment pep:known_by_projection scaffold:PapAnu2.0:JH680086.1:168406:170490:1 gene:ENSPANG00000011132 transcript:ENSPANT00000004230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNT
SNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDS
KKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAV
REVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLAVGSRCLKTFEVPE
ENTAETITRVLYEVFIEWGISAKVFGATTNYGKDIVKACSLLDIAVHMPCLGHTFNAGIQ
QAFQLPKLGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAM
LQRLKEQQFVIAGVLVEDSNNHHLMLEASEWATIEGLVELLQPFKQVAEMLSASRYPTIS
MVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYK
RLPFLSAFERQQVENRVVEEAKGLLDKVKDGGYRPAEDKIFPVPEEPPVKKLMRTSTPPP
TSVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPL
LPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRLAPAHVDEQVFLYENARSGAEAEPE
DQDEGEWGLDQEQVFSLGDGVSGGFFGIRDSSFL
Download sequence
Identical sequences A0A096N3S3
ENSPANP00000007008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]