SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007019 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007019
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily EF-hand 9.9e-23
Family S100 proteins 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007019   Gene: ENSPANG00000014083   Transcript: ENSPANT00000025703
Sequence length 98
Comment pep:known_by_projection chromosome:PapAnu2.0:1:127354688:127361607:-1 gene:ENSPANG00000014083 transcript:ENSPANT00000025703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLQKELPSFVGEKVDEEGLKKLM
GNLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP
Download sequence
Identical sequences A0A096N3S8 A0A0D9S5N7 A0A2K5WB64 A0A2K6DD90 F7GDD5
ENSPANP00000007019 ENSMMUP00000014387 XP_001110950.1.72884 XP_005541829.1.63531 XP_005541830.1.63531 XP_007975264.1.81039 XP_011767779.1.29376 XP_011767780.1.29376 XP_015008490.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]