SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007027 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007027
Domain Number 1 Region: 509-777
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.86e-112
Family N-acetyl transferase, NAT 0.0000000000592
Further Details:      
 
Domain Number 2 Region: 251-322
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.07e-17
Family PHD domain 0.0056
Further Details:      
 
Domain Number 3 Region: 92-175
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000446
Family Linker histone H1/H5 0.022
Further Details:      
 
Domain Number 4 Region: 195-263
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000226
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007027   Gene: ENSPANG00000021919   Transcript: ENSPANT00000000255
Sequence length 1931
Comment pep:known_by_projection chromosome:PapAnu2.0:8:40197513:40315816:-1 gene:ENSPANG00000021919 transcript:ENSPANT00000000255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
CCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKMTLSSQSASSSSEEGYLERIDGLDFCRDSSVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTADNQDGWDGKQENEERLFGSQEIMTE
KDMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYL
CEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKL
FLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYG
RFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKL
TGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPV
IVSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSCENKEQDSYSVESEKKPEVTA
PVSSTRLNKQVLPRDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQY
GECEEKSEATQEQYTESEEQLVASQEQLSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALK
CRLTEGNERLPRRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLSERKPFLHR
RRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENEL
FPREYFHCLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLE
PDTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPVVPIPKAG
RRPKIQESEETVEPKEDMPLTEAASSEVPVASPADSSNSPETETKEPEVEEEEEKPRVSE
EQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDEDDGHLESTKKKELEEQPTREDV
KEEPGVQESFLDANTQKSREKIKDKEETELDSEEEQPSHDTSVVSEQMPGSEDDHEEDSH
TKEELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHESAYQDCEETLAACQTLQSYTQ
ADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSA
PSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNS
SSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQQSSVQPAANCSIKSPQSCVVE
RPPSNQQQLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFSL
AKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPP
PNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQ
LYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMN
SSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVP
KQSLNGPYMRR
Download sequence
Identical sequences ENSPANP00000007027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]