SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007042 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007042
Domain Number - Region: 188-263,321-353
Classification Level Classification E-value
Superfamily TPR-like 0.0038
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007042   Gene: ENSPANG00000020407   Transcript: ENSPANT00000026969
Sequence length 511
Comment pep:novel chromosome:PapAnu2.0:3:139010036:139221555:1 gene:ENSPANG00000020407 transcript:ENSPANT00000026969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGTESSLSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRP
LLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYY
DMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEALEINECATAYILLA
EEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCA
RRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDDISLPKS
ATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSL
ILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPY
PICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKA
FLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Download sequence
Identical sequences A0A1D5QPA9 A0A1S3FGN1 A0A1U7TQ82 A0A287BHL3 A0A287DEZ4 A0A2I2YR23 A0A2I3GU99 A0A2I3TT95 A0A2J8UPD8 A0A2K5D0F8 A0A2K5P6C0 A0A2K5Q2J4 A0A2K5UL95 A0A2K5XY65 A0A2K6DZ33 A0A2K6UCR4 F7HBK2 G3XAH9 M3WII4
ENSPANP00000007042 ENSCJAP00000044691 ENSMMUP00000028605 ENSP00000377090 ENSP00000377090 NP_001076784.1.92730 XP_003921105.1.74449 XP_004046145.1.27298 XP_004592532.1.84141 XP_004644913.1.9945 XP_004658631.1.11716 XP_004677027.1.23501 XP_005363814.1.66349 XP_005877760.1.60319 XP_005899202.1.15283 XP_005961075.1.78601 XP_006100251.1.53796 XP_007089225.1.5354 XP_007450841.1.90284 XP_007980879.1.81039 XP_008059950.1.4292 XP_008150644.1.99482 XP_008579250.1.73410 XP_008835487.1.79516 XP_008958967.1.60992 XP_009452311.1.37143 XP_011729327.1.29376 XP_011847881.1.47321 XP_011943216.1.92194 XP_012312405.1.9421 XP_012367660.1.23891 XP_012388493.1.21590 XP_012875460.1.60039 XP_014640974.1.5094 XP_014693881.1.49734 XP_014922816.1.86478 XP_014990234.1.72884 XP_015303462.1.63531 XP_017390563.1.71028 XP_019814282.1.53367 XP_020934078.1.46622 XP_021555093.1.83697 XP_021586702.1.77405 ENSMUSP00000111077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]