SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007049 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007049
Domain Number 1 Region: 418-715
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-40
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 54-209,241-319
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.24e-38
Family WD40-repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007049
Domain Number - Region: 970-1063,1214-1239
Classification Level Classification E-value
Superfamily TPR-like 0.0177
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007049   Gene: ENSPANG00000024861   Transcript: ENSPANT00000016890
Sequence length 1515
Comment pep:known_by_projection chromosome:PapAnu2.0:6:148350270:148399569:-1 gene:ENSPANG00000024861 transcript:ENSPANT00000016890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGEL
VGHTERVSGFTFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPR
VKDLIVSGDEKGVVFCYWLNRNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIID
ISKKGEVIHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGC
YLATGSKDQTIRIWSCSRGRGVMILKLPFLKRRGGGIDPTVKERLWLTLHWPSNQPTQLV
SSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRD
VKCWDMATLECCWTLPSLGGFAYSLAFSSVDVGSLAIGVGDGMIRVWNTLSIKNNYDVKH
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGP
PVPPMSLVHTGEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPV
HTEISWKADGKIMALGNEDGSIEIFQVPNLKLICTIQQHHKLVNTISWHHEHGSQPELSY
LMASGSNNAVIYVHNLKTVIESSPESPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSA
SYDGTAQVWDALREEPLCNFRGHRGRLLCVTWSPLDPDCIYSGADDFCVHKWLTSMQDHS
RPPQGKKSIELEKKRLSQPKPKPKKKKKPTLRTPVKLESIDRNEEESMKENLGPVENGVS
DQEGEEEAREPELPCGLAAAEPVIREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKP
EALIKKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSKVTEPNEDVSADLEERFHLG
LFTDRATLYRMIDIEGKGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAP
AAAGYHVWLWAVEAFAKQLCFQDQYVKAASHLLSIHKVYEAVELLKSNHFYREAIAIAKA
RLRPEDPVLKDLYLSWGTVLERDGHYAVAAKCYLGATCAYDAAKVLAKKGDAASLRTAAE
LAAIIGEDELSASLALRCAQELLLANNWVGAQEALQLHASLQGQRLVFCLLELLSRHLEE
KRFSEGKSSSSYHTWTTGTEGPFVERVTAVWKSIFSVDTPEQYQEAFQKLQNIKYPSATN
NTPAKQLLLHICHDLTLAVLSQQMASWDEAVQALLQAVVRSYDSGSFTIMQEVYSAFLPD
GCDHLRDKLGDRQSPAMPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVGTGHKTLSVE
PSQQVDTASTEETDPETSQPEPNTPSELDLRLTEEGERILSTFKELFSEKHASLQNSQRT
VAEVQETLAEMIRQHQRSQLCKSTANGPDKNELEVEAEQPLSSSQSQCKEEKNEPLSLPE
LTKRLTEANERMAKFPESIKAWPFPDVLECCLVLLLIRSHFPGCLAQEMQQQALELLQKY
GNTKTYKRHCQTFCT
Download sequence
Identical sequences ENSPANP00000007049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]