SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007050 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007050
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily RUN domain-like 4.32e-31
Family RUN domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 458-498
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000528
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007050
Domain Number - Region: 159-219
Classification Level Classification E-value
Superfamily Fibritin 0.0337
Family Fibritin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007050   Gene: ENSPANG00000011686   Transcript: ENSPANT00000016580
Sequence length 501
Comment pep:novel chromosome:PapAnu2.0:6:100084076:100085977:-1 gene:ENSPANG00000011686 transcript:ENSPANT00000016580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNYLVAKEHMNLINTAKLSIKGLVESALNLERTLDSDYAPLQQFFVVMEHSLKQGLKTQN
KAFWGDLPGLKTPVGRERAWLCLALMQKKLSYMKALINKNEFYEPSALMMEEEGAIIDGL
LVGLNVIDANFSVKGEDLDSQVGVIHFSMYFKNRNSSKSSEGDSQIIAILDQKNFVQELN
RHLNATVNNLQAKVDALEKSNTKLTEELEVANSRITTLQFKEESSYILKSSWKGPKQDRI
AEGQAPSEARNHLKEETQLPLDVEKELEIQISMRQEMKMLQKDVCEKQDAPVSLQRQLDA
LRPLRHELAFKLQSSDLGVKQKSELNSSLEQKTNQMTAIIKQLEQKWHQAERNCQSAELN
NRLFKQDFEDKINSLQLEVEELTRQWNQPENNRNIPGKGSQKPESKMDGKHKMQKENVKL
KMPLEESHRLQPHPGDEQDQLLLPEKPQVCQLRQEDVRNCRGTFCHACSTNELPLPSTMK
PERVCNPCHEHLMKKVNSLES
Download sequence
Identical sequences ENSPANP00000007050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]