SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007077 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007077
Domain Number 1 Region: 201-528
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-93
Family Protein kinases, catalytic subunit 0.0000000505
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007077
Domain Number - Region: 151-189
Classification Level Classification E-value
Superfamily PX domain 0.00353
Family PX domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007077   Gene: ENSPANG00000010260   Transcript: ENSPANT00000000133
Sequence length 558
Comment pep:known_by_projection chromosome:PapAnu2.0:4:128323216:128332432:1 gene:ENSPANG00000010260 transcript:ENSPANT00000000133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIVLFPLEQRRLLFPPPPLHIPDLSLPPFPLSFLPSSSSKFWDFSALLGFGQKHKKGVF
GSDPTVHKGHLFVLGLGAGNLARPESRRLLQGNVSARRSLSPAVRPAARCPLPMGEMQGA
LARARLESLLRPRHKKRAEAQKRSESFLLSGLAFMKQRRMGLNDFIQKIANNSYACKHPE
VQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVL
LARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLY
FVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQ
GHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYG
LPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHV
FFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSILVTASVKE
AAEAFLGFSYAPPTDSFL
Download sequence
Identical sequences ENSPANP00000007077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]