SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007079 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007079
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily EF-hand 1.37e-33
Family Calmodulin-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007079   Gene: ENSPANG00000022523   Transcript: ENSPANT00000026745
Sequence length 175
Comment pep:known_by_projection chromosome:PapAnu2.0:3:67091434:67093910:1 gene:ENSPANG00000022523 transcript:ENSPANT00000026745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKEEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Download sequence
Identical sequences A0A096N3Y4 A0A0D9RSS6 A0A1D5QZ41 A0A2K5HH62 A0A2K5MY14 A0A2K5WKW5 A0A2K5ZRY2 A0A2K6BE59 A0A2K6MLY3 A0A2K6Q4G4
XP_001095719.1.72884 XP_005549741.1.63531 XP_007979653.1.81039 XP_010372860.1.97406 XP_011760763.1.29376 XP_011802152.1.43180 XP_011838630.1.47321 XP_011939902.1.92194 XP_017750430.1.44346 ENSPANP00000007079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]