SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007093 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007093
Domain Number 1 Region: 370-573,665-704,828-916
Classification Level Classification E-value
Superfamily TPR-like 2.75e-67
Family Tetratricopeptide repeat (TPR) 0.00019
Further Details:      
 
Domain Number 2 Region: 33-325
Classification Level Classification E-value
Superfamily TPR-like 1.82e-58
Family Tetratricopeptide repeat (TPR) 0.0000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007093   Gene: ENSPANG00000026426   Transcript: ENSPANT00000008451
Sequence length 1046
Comment pep:known_by_projection chromosome:PapAnu2.0:X:62944173:62984386:1 gene:ENSPANG00000026426 transcript:ENSPANT00000008451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLL
LSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKP
DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACY
LKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARI
FDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF
AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTR
AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWT
DYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHK
PPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQA
MWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAV
IDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMN
TIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPED
AIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQL
TCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLY
LQMWEHYAAGNKPDHMIKPVEVTESA
Download sequence
Identical sequences A0A0P6J3D0 A0A2I3LNS1 A0A2J8UBL9 A0A2K5CKG4 A0A2K5NXC0 A0A2K5QQV2 A0A2K5Y7J8 A0A2K6DJU8 F6Z4I6 F7G0L9 G7Q303 H0VRL3 H9G0W3 I3MIG1 K7GSL3 P81436
ENSOCUP00000014582 ENSCPOP00000013230 10141.ENSCPOP00000013230 9796.ENSECAP00000021460 9823.ENSSSCP00000013198 9986.ENSOCUP00000014582 ENSCPOP00000013230 ENSECAP00000021460 XP_001493422.1.31192 XP_002720149.1.1745 XP_002763023.1.60252 XP_003471044.1.53824 XP_004022227.1.66739 XP_004439899.1.5094 XP_004646842.1.9945 XP_005339998.1.77405 XP_005401729.1.28644 XP_005593976.1.63531 XP_005673769.1.46622 XP_005954852.1.78601 XP_007461647.1.90284 XP_008155829.1.99482 XP_010971897.1.22495 XP_010977065.1.51371 XP_011731043.1.29376 XP_011847460.1.47321 XP_011916150.1.92194 XP_011997691.1.54773 XP_012330457.1.9421 XP_013831850.2.57651 XP_013841689.1.46622 XP_014419046.1.101512 XP_014584445.1.31192 XP_014693170.1.49734 XP_014983152.1.72884 XP_015106177.1.17985 XP_017372220.1.71028 XP_021575590.1.77405 ENSPANP00000007093 ENSSSCP00000013198 ENSSSCP00000030900 ENSCJAP00000024554 ENSCJAP00000024576 ENSECAP00000021460 ENSOCUP00000014582 ENSSSCP00000013198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]