SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007097 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007097
Domain Number 1 Region: 779-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 369-573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.18e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 585-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-34
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 175-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 992-1132,1161-1203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Domain Number 6 Region: 2-86
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000749
Family Laminin G-like module 0.034
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007097
Domain Number - Region: 97-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000308
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007097   Gene: ENSPANG00000004471   Transcript: ENSPANT00000005641
Sequence length 1598
Comment pep:known chromosome:PapAnu2.0:14:9369597:9488311:1 gene:ENSPANG00000004471 transcript:ENSPANT00000005641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLTRDARRTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEP
PFRGLLANLKLGERPPALLGSQGLRGATADPLCAPARNPCANGGLCTVLAPGEVGCDCSH
TGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFK
GNEFFCYDLSHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLG
SGAFEALVEPVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVNKLHYLVTISVDGILTTTGY
TQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGD
PKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFS
QGRRAGGGTGSHSSAQRADYFAMELLDGHLYLLLDMGSGGIKLRASSRKVNDGEWCHVDF
QRDGRKGSISVNSRSTPFLATGDSEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAG
YVGCVRDLFIDGRSRDLRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGICREGWNRFV
CDCIGTGFLGRVCEREATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATT
SRESADTLRLELDGGQMKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGK
SLQLSVDNVTVEGQMAGAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYM
DQCKDGDITYCELNARFGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDG
LLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNV
HTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKSMFSNLPKLVASRDGFQGCLASVDLNG
RLPDLIADALHRIGQVERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCN
DPGTTYIFGKGGALITYTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQL
HIDQGTVGVIFNVGTDDITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAG
NFDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGL
YYNGLKVLALAAESDPNVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMA
TTTTRRGRSPTLRDSTTQNTDDLLVASAECPSDDEDLEECEPSTGECLSPLPCPGALWPG
IIPARSPFHHPGPYFLPCLVRPSSTRDMTHPPLPRRPPRGGRCRTDRQKTFQLEPIWASG
FASGEVFDSSLPPTDDEDFYTTFPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLFAPS
APAPNLPAGKMNHRDPLQPLLENPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPHLPTANP
TGPGERGPPGAVEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSR
NYISNSAQSNGAVVKEKAPTAPKTPSKAKKNKDKEYYV
Download sequence
Identical sequences ENSPANP00000007097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]