SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007102 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007102
Domain Number 1 Region: 417-571
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.22e-24
Family Synaptotagmin-like (S variant) 0.0012
Further Details:      
 
Domain Number 2 Region: 251-387
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.78e-20
Family Synaptotagmin-like (S variant) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007102   Gene: ENSPANG00000020300   Transcript: ENSPANT00000008043
Sequence length 574
Comment pep:known_by_projection chromosome:PapAnu2.0:1:153921344:154136298:-1 gene:ENSPANG00000020300 transcript:ENSPANT00000008043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIEGGERTCGVHELICIRKVSPEAVGFLSAVGVFIILMLLLFLYINKKFCFENVGGFPD
LGSEYSTRKNSQDKIYNSYMDKDEHGSSSESEDEALGKYHEALSRTHNSRLPLADSRQKN
YAWETRQKYSPLSAEYDGYSSEASIDEGNCIQRMRRTPPLDELQPPPYQDDSGSPHLSCT
PSEIGDSKCEFSHCSNSPRCSYNKCPSEGSTGHEIESFHNKGYEEDVPSDSTAVLSPEDI
SAQGSSSQLPKPFDPEPEAKYGTLDVTFDYDSQEQKLLVTVTAVTDIPTYNRTGGNSWQV
HLVLLPIKKQRAKTSIQRGPCPVFTETFKFNHVESEMIGNYAVRFRLYGVHRMKKEKIVG
EKIFYLTKLNLQGKMSLPVILEPSYNHSGCDSQMSMSEMSCSESTSSCQSLEHGSVPEIL
IGLLYNATTGRLSAEVIKGSHFKNLAANRPPNGLFCCLKHLIGGQVYIIRDTYVKLTLLN
SMGQEMSKCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLILSVYNKRSMKRKEMIGWIS
LGLNSSGEEELNHWTEMKESKGQQVCRWHALLES
Download sequence
Identical sequences A0A096N406 A0A2K5N2Y3
XP_011896222.1.92194 ENSPANP00000007102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]