SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007138 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007138
Domain Number 1 Region: 16-158
Classification Level Classification E-value
Superfamily EF-hand 3.8e-43
Family Calmodulin-like 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007138   Gene: ENSPANG00000010181   Transcript: ENSPANT00000014849
Sequence length 161
Comment pep:known_by_projection chromosome:PapAnu2.0:6:84454392:84468419:-1 gene:ENSPANG00000010181 transcript:ENSPANT00000014849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSELVVDKTKRKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADV
LKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRV
ARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Download sequence
Identical sequences ENSPANP00000007138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]