SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007145 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007145
Domain Number 1 Region: 769-975
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000989
Further Details:      
 
Domain Number 2 Region: 280-562
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-47
Family FCH domain 0.0078
Further Details:      
 
Domain Number 3 Region: 696-749
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007145   Gene: ENSPANG00000013187   Transcript: ENSPANT00000017455
Sequence length 1098
Comment pep:known_by_projection chromosome:PapAnu2.0:19:795289:817475:1 gene:ENSPANG00000013187 transcript:ENSPANT00000017455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRKKRDLMKTPSISKKNRAGSPSPQPSGELPRKDAVDAVFPGPSLEPSAGSSSAKATG
TLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGEQPTEGAGPDGVEDISHLL
ADVARFAEGLEKLKECVLHDDLLEARRPLAHECLGEALRVMRQIISKYPLLNTVETLTAA
GTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSS
QSMESLYGPGSEGTPPGLDDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLI
SYLEKRTTLEMEFAKGLQKISHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHGMVQAVGT
LQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYTQRCEDHDKAR
LLVAKAEEEQAGTTLGAGSTVTKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQEL
EDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQY
ASHVRQLQRDQEPDVHYDFEPHVSANAWSPVLRARKSSFNVSDVAGPEAAGSPPEEGIEG
APAKERRAGRGHQVHKSWPLSISDSDSGLDTGPGTGDFKKFERTSSSGTMSSTEELVDSE
GGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSYVY
FQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSQAARSAPDGVPFIVKKCV
CEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPE
PLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVAMAGRLRELLRDLPLEN
RASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARV
IETLIVHYGLVFEEEPEETPGGQDESSSQRAEVVIQVPYLEAGEGVVYPLQEAAEDGCRE
SRVVSNDSDSDLEEASELLSSSEASALRRLSLLEQQQSEASLEEASGSHSGSEEQLEAXX
XXXXXXXXXXXXXXXRCL
Download sequence
Identical sequences ENSPANP00000007145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]