SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007169 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007169
Domain Number 1 Region: 617-722
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 327-431
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-29
Family SH2 domain 0.00000218
Further Details:      
 
Domain Number 3 Region: 118-267
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-17
Family BCR-homology GTPase activation domain (BH-domain) 0.00029
Further Details:      
 
Domain Number 4 Region: 5-79
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000115
Family SH3-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007169   Gene: ENSPANG00000002533   Transcript: ENSPANT00000007748
Sequence length 732
Comment pep:novel chromosome:PapAnu2.0:19:16667427:16685672:1 gene:ENSPANG00000002533 transcript:ENSPANT00000007748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQNVGWMPGL
NERTRQRGDFPGTYVEFEGGKGLSFPTHRPECHPPPLPLNPSNRPPSLLPPPGLTLPDLP
EQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPTPRTDWTLSDVDQWDVTALADGIK
SFLLALPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVARR
APALGPAVRALGATFGPLLLRAPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQE
VAPPALPPKPPKAKLAPAGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRD
ASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAK
LDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQM
KRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIH
ESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKIMGSLG
TPRPDPSQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYA
CSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPV
RAPGPGPPPAAR
Download sequence
Identical sequences ENSPANP00000007169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]