SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007196 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007196
Domain Number 1 Region: 416-551
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-41
Family Synaptotagmin-like (S variant) 0.00000593
Further Details:      
 
Domain Number 2 Region: 277-406
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.38e-38
Family Synaptotagmin-like (S variant) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007196   Gene: ENSPANG00000005601   Transcript: ENSPANT00000020286
Sequence length 564
Comment pep:known_by_projection chromosome:PapAnu2.0:1:114919856:114984170:-1 gene:ENSPANG00000005601 transcript:ENSPANT00000020286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPREGRGPCGEVIKSRAEPQGAAAGRVFLGPSCPAPVRPRRGFELLLGRPGCLGHERGWG
AGGPRCQEALAVLTSLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSLLAVVVI
VCGVALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLG
FLEAAVKISHTSPDIPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVS
SVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGDDAKSEATKSCGKINFSLRYDYETETL
IVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEE
LADRKLHLSVFDFDRFSRHDMIGEVIMDNLFEASDLSRETSIWKDIQYATSESVDLGEIM
FSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNP
VYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGINAEGLGRDHWNEMLAYP
RKPIAHWHSLVEVKKSFKEGNPRL
Download sequence
Identical sequences ENSPANP00000007196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]