SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007202 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007202
Domain Number 1 Region: 38-245
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.69e-50
Family Rhodopsin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007202   Gene: ENSPANG00000019532   Transcript: ENSPANT00000004607
Sequence length 264
Comment pep:known_by_projection chromosome:PapAnu2.0:1:33824194:33828163:1 gene:ENSPANG00000019532 transcript:ENSPANT00000004607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSATPGAQMGVPTGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPVSLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLTVMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQVRPTLVSLCGLGVGVLLV
Download sequence
Identical sequences ENSPANP00000007202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]