SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007210 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007210
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 67-113,507-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007210   Gene: ENSPANG00000006998   Transcript: ENSPANT00000020047
Sequence length 561
Comment pep:known_by_projection chromosome:PapAnu2.0:6:38711102:38796736:-1 gene:ENSPANG00000006998 transcript:ENSPANT00000020047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSACWSFAAAICILEISVLTAEYTPSYDPQPTESRGPTSHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKSCTDAVGDRRQCVPTEPCEDAEDDCGNDFKCGTGRCIKRRLLCN
GDNDCGDFSDEDDCESDPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNLRTEHYEEQIEAFKSIVQEKTSNFNADIS
LKFTPTEANKVKTEKPSEKKASSNSPHGQGNFRFSYSKNETYQLFLSYSSKKEKMFLHVK
GEIHLGRFMMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYEL
IYVLDKASMNRKGVELKDVKRCLGYHLDVSLDFSKISAGANVDKDDCVKRGEGRAVNITS
DHLIDDVISLIRGGTRQYAFELKEKLLRGTMIDVTDFVNWASSINDAPVLISQKLSPIYN
LVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHSCQNGGTAILMDGKCLCTCPFKFEGIA
CEISKQKVSEGLPALDFPREK
Download sequence
Identical sequences A0A096N4A4
ENSPANP00000007210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]