SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007217 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007217
Domain Number 1 Region: 42-187
Classification Level Classification E-value
Superfamily TPR-like 2.14e-22
Family Tetratricopeptide repeat (TPR) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007217   Gene: ENSPANG00000026428   Transcript: ENSPANT00000001153
Sequence length 204
Comment pep:known_by_projection chromosome:PapAnu2.0:19:34494987:34497391:-1 gene:ENSPANG00000026428 transcript:ENSPANT00000001153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGALSPVLMLSAAPEHGSARPGPTPEPSGSLGAALDSSLRAAVAFKAEGQRCYREKKF
REAIGKYHRALLQLKAAQASSPGPARLSEEQRRLVESTEVECYDSLTACLLQSELVNYER
VREYCLKVLEKQQGNFKATYRAGIAFYHLGDYARALRYLQEARSREPTDTNVLRYIQLTQ
LKMNRCSLQREDSGAGAQTRDVIG
Download sequence
Identical sequences ENSPANP00000007217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]