SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007228 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007228
Domain Number 1 Region: 3-123,253-360
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-42
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000007228
Domain Number - Region: 671-702
Classification Level Classification E-value
Superfamily TPR-like 0.0449
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007228   Gene: ENSPANG00000019172   Transcript: ENSPANT00000018343
Sequence length 852
Comment pep:known_by_projection chromosome:PapAnu2.0:14:103250665:103283474:-1 gene:ENSPANG00000019172 transcript:ENSPANT00000018343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQLFYGTFLTEGVREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHS
VKYGQERWFTKLPPVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRN
KRECIRKLKEEIKILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDT
HMTLPLSSVHCPVSDQTSKESTSTESSSLDVESSFSSPEDSLHKSKPLTSSRSSMEMPAQ
PAPRTVTDEEINFVKTCLQRWRSEIEQDIQDLKNCIASTTQTIEQMYCDPLLRQVPYRLH
AVLVHEGQANAGHYWAYIYNQPQQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMY
INDKLPYFNAEAAPNESDQMSEVEALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQME
SSTNSSSQDFSTSQEPSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALS
ELKEAEPKKPMPQETNLAEQSEQPPKANDAESTAQPNSEVSEVEIPSVGRILVRSDADGY
DEEVMLSPAMQGVILAIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRL
QHVLVYFFQNEAPKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEY
KKWHEDYSLFRKVSVYLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVI
ALYRRKCLLELNAKAASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEV
MRNHWCSYLGQDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVM
ESIQGVSTVTVK
Download sequence
Identical sequences ENSPANP00000007228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]