SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007233 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007233
Domain Number 1 Region: 51-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000132
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 324-370
Classification Level Classification E-value
Superfamily RING/U-box 0.00000013
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 267-303
Classification Level Classification E-value
Superfamily SAP domain 0.0000168
Family SAP domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007233   Gene: ENSPANG00000002377   Transcript: ENSPANT00000008280
Sequence length 376
Comment pep:known_by_projection chromosome:PapAnu2.0:11:120711333:120731947:1 gene:ENSPANG00000002377 transcript:ENSPANT00000008280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKAGATSMWASCCGLLNEVMGTGAVRGQQSGFAGATGPFRFTPNPEFSTYPPAATEGPN
IVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLK
VKDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSF
FSNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEEEEEEEDDE
ENVEDRNPGLSKERARASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKV
NRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSEC
PICRQYVVRAVHVFKS
Download sequence
Identical sequences A0A2I3MQH7
ENSPANP00000007233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]