SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007238 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007238
Domain Number 1 Region: 102-583
Classification Level Classification E-value
Superfamily TPR-like 1.54e-60
Family HAT/Suf repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 796-887
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.75e-23
Family Canonical RBD 0.0055
Further Details:      
 
Domain Number 3 Region: 699-789
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-19
Family Canonical RBD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007238   Gene: ENSPANG00000024915   Transcript: ENSPANT00000006175
Sequence length 963
Comment pep:known_by_projection chromosome:PapAnu2.0:11:107644632:107679318:-1 gene:ENSPANG00000024915 transcript:ENSPANT00000006175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAATSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTVGPGWDQQEE
GVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIR
LLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDY
ICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVE
AARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPVPESVIQNYNKALQQLEKYKPYEE
ALLQAEAPRLSEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKV
KDLVLSVHNRAVRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEI
WQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWAR
IEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSD
YPEHVCEVLLTMERTEGSLEDWDTAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQ
RKRARAEKKALKKKKKTRGPEKRGADEDNEKEWGDDEEEQPSKRRRVENSIPAAGETQNI
EVAAGPAGKCATVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDV
KLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPC
VDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKP
KGLAYVEYENESQASQAVMKMDGMTIKENVIKVAISNPPQRKVPEKPETRKAPGGPMLLP
QTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAASAATEAPKMSNADFAKLF
LRK
Download sequence
Identical sequences ENSPANP00000007238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]