SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007248 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007248
Domain Number 1 Region: 348-428
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.35e-28
Family PB1 domain 0.0000055
Further Details:      
 
Domain Number 2 Region: 459-517
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-20
Family SH3-domain 0.0000579
Further Details:      
 
Domain Number 3 Region: 6-143
Classification Level Classification E-value
Superfamily TPR-like 2.49e-19
Family Tetratricopeptide repeat (TPR) 0.000000138
Further Details:      
 
Domain Number 4 Region: 232-317
Classification Level Classification E-value
Superfamily SH3-domain 1.19e-18
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007248   Gene: ENSPANG00000025277   Transcript: ENSPANT00000004365
Sequence length 526
Comment pep:known_by_projection chromosome:PapAnu2.0:1:180677012:180713634:1 gene:ENSPANG00000025277 transcript:ENSPANT00000004365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMHTILKNMTEAEKAF
TKSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFA
CEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVG
RLFRPNERQVAQLAKKDYLGKATVVASVVDHDSFSGFAPLQPQAAEPPPRPKTPEIFRAL
EGEAHRVLFGFVPETQEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELR
IHPQQQPQEESSPESDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKY
TVVMETQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDNMKDAWGQVKNY
CLTLWCENTVGDQGFPDEPKESEKADANNQTTDTQLKKGSQVEALFSYEATQPEDLEFQE
GDIILVLSKVNDEWLEGECKGKVGIFPKVFVEECATTDLESTRREV
Download sequence
Identical sequences A0A2I3NHU8
ENSPANP00000007248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]