SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007279 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007279
Domain Number 1 Region: 75-234
Classification Level Classification E-value
Superfamily EF-hand 2.43e-27
Family Calmodulin-like 0.02
Further Details:      
 
Domain Number 2 Region: 204-306
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000418
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007279   Gene: ENSPANG00000018409   Transcript: ENSPANT00000005930
Sequence length 331
Comment pep:known_by_projection chromosome:PapAnu2.0:14:32738582:32750916:-1 gene:ENSPANG00000018409 transcript:ENSPANT00000005930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGGRGRRLGFALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH
EAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNV
AKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADL
DGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP
EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKL
TKEEILENWNMFVGSQATNYGEDLTKNHDEL
Download sequence
Identical sequences A0A096N4G2 A0A2K5KMG6 A0A2K5UMV2 A0A2K6C020 H9EU26
ENSPANP00000007279 XP_005578346.1.63531 XP_008001003.1.81039 XP_011722297.1.29376 XP_011917532.1.92194 XP_014970067.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]