SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007309 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007309
Domain Number 1 Region: 259-363
Classification Level Classification E-value
Superfamily PH domain-like 3.02e-30
Family Pleckstrin-homology domain (PH domain) 0.00000286
Further Details:      
 
Domain Number 2 Region: 132-243
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-29
Family DEP domain 0.000000898
Further Details:      
 
Domain Number 3 Region: 29-126
Classification Level Classification E-value
Superfamily PH domain-like 2.29e-20
Family Pleckstrin-homology domain (PH domain) 0.00000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007309   Gene: ENSPANG00000005755   Transcript: ENSPANT00000022380
Sequence length 366
Comment pep:known_by_projection chromosome:PapAnu2.0:13:67252505:67318761:1 gene:ENSPANG00000005755 transcript:ENSPANT00000022380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGNSMQTSLIASVVPKLLAGNAVTMNQIKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSP
KGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHFFQAAFLEERDAWVRDIKKAIKCIE
GGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDW
LVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGF
FCEENSSDDDVILKEEFRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDPAGAE
DPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITADEVHYFLQAASPKERTEWIKAIQV
ASRTGK
Download sequence
Identical sequences ENSPANP00000007309 XP_015289066.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]